PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 470852
Common NameARALYDRAFT_470852
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GATA
Protein Properties Length: 304aa    MW: 33845.1 Da    PI: 8.6716
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
470852genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.22.6e-19222256135
    GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
             C++C ttkTp+WR+gp g ktLCnaCG+++r+ +l
  470852 222 CTHCETTKTPQWREGPKGRKTLCNACGVRFRSGRL 256
             *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004019.3E-19216266IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.991220252IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.19E-14220279No hitNo description
Gene3DG3DSA:3.30.50.103.9E-15220253IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.53E-15221270No hitNo description
PfamPF003204.4E-17222256IPR000679Zinc finger, GATA-type
PROSITE patternPS003440222247IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MNRLPEAEAE EDFKGLLSGD FFDDLINHLD CPLEDIDSTN VEGDWVARFQ DLEPPPMDMF  60
PSLPSELISC ATGGRLGIQR NMIPAFKQSC SSEALSSIDT TLHQSSAPPD IKVSKLFQSL  120
SPVSVLENSY GSLSTQNSGS QRLAFPVKGM RSKRKRPTTL RLSYLFPSEP RKPEKSTPAE  180
SESESYYSSE QHAKKKRKIH LTTRTVSSSS EASNSDGIVR KCTHCETTKT PQWREGPKGR  240
KTLCNACGVR FRSGRLVPEY RPASSPTFIP SVHSNSHRKI VEMRRKDDEQ FDTSMIRAVI  300
SRG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2293660.0AK229366.1 Arabidopsis thaliana mRNA for putative GATA transcription factor 3, complete cds, clone: RAFL16-61-D15.
GenBankBT0149740.0BT014974.1 Arabidopsis thaliana At1g08010 gene, complete cds.
GenBankBT0157130.0BT015713.1 Arabidopsis thaliana At1g08010 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002892428.10.0zinc finger family protein
SwissprotQ6DBP80.0GAT11_ARATH; GATA transcription factor 11
TrEMBLD7KHX90.0D7KHX9_ARALL; Zinc finger family protein
STRINGfgenesh2_kg.1__806__AT1G08010.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.20.0GATA transcription factor 11